Anti-SSR1 Antibody
Cat: CD-EMA-001220

Inquiry Size: 100 µL
Product Details
Host Species Rabbit
Species Reactivity C. elegans, Human, Mouse, Rat
Conjugate NONE
Immunogen Amino acid corresponding recombinant protein: ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
Format Liquid or Lyophilized
Purification Affinity purified
Product Overview This product is a Rabbit antibody against the SSR1. It can be used for SSR1 detection in Western Blot, Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin.
Availability Made-to-order
Target Information
Target Name SSR1
Gene ID 6745
UniProt ID P43307
Introduction The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are mostly non-canonical. Multiple transcript variants encoding different isoforms have been found for this gene.
Usage
Application IF, IHC, IHC-P,WB
Application Notes Western Blot 0.04-0.4 µg/mL
Immunocytochemistry/Immunofluorescence 0.25-2 µg/mL
Immunohistochemistry 1:500-1:1000
Immunohistochemistry-Paraffin 1:500-1:1000
Shipping & Handling
Shipping Shipped on dry ice.
Storage Store at 4 °C: short-term (1-2 weeks)
Store at -20 °C: long-term and future use
Buffer PBS, pH 7.2, 40% Glycerol
For Research Use Only. Not For Clinical Use.

Related Products

Products
Online inquiry

C. elegans - CD BioSciences

A Professional C. elegans Model Provider

  • Tel:
  • Email:

Copyright © 2026 CD BioSciences. All rights reserved.