| Host Species | Rabbit |
| Species Reactivity | C. elegans, Human, Mouse, Rat |
| Conjugate | NONE |
| Immunogen | Amino acid corresponding recombinant protein: ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE |
| Format | Liquid or Lyophilized |
| Purification | Affinity purified |
| Product Overview | This product is a Rabbit antibody against the SSR1. It can be used for SSR1 detection in Western Blot, Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Availability | Made-to-order |
| Target Name | SSR1 |
| Gene ID | 6745 |
| UniProt ID | P43307 |
| Introduction | The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are mostly non-canonical. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Application | IF, IHC, IHC-P,WB |
| Application Notes | Western Blot 0.04-0.4 µg/mL Immunocytochemistry/Immunofluorescence 0.25-2 µg/mL Immunohistochemistry 1:500-1:1000 Immunohistochemistry-Paraffin 1:500-1:1000 |
| Shipping | Shipped on dry ice. |
| Storage | Store at 4 °C: short-term (1-2 weeks) Store at -20 °C: long-term and future use |
| Buffer | PBS, pH 7.2, 40% Glycerol |
For Research Use Only. Not For Clinical Use.Related Products
Copyright © 2026 CD BioSciences. All rights reserved.