| Host Species | Mouse |
| Species Reactivity | C. elegans, Human |
| Conjugate | NONE |
| Clone Number | 1A1 |
| Specificity | ODF2 - outer dense fiber of sperm tails 2 (1A1). |
| Immunogen | ODF2 (NP_002531.3, 706 a.a.~804 a.a) partial recombinant protein with GST tag. The MW of only the GST tag is 26 KDa. KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP. |
| Format | Liquid or Lyophilized |
| Product Overview | Mouse Anti-C. elegans ODF2 (clone 1A1) Antibody is a Mouse antibody against the epitope of the ODF2. It can be used for ODF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay, Immunofluorescence, Immunohistochemistry. |
| Availability | Made-to-order |
| Target Name | ODF2 |
| Gene ID | 4957 |
| UniProt ID | Q5BJF6 |
| Introduction | The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. This gene encodes one of the major outer dense fiber proteins. Alternative splicing results in multiple transcript variants. The longer transcripts, also known as 'Cenexins', encode proteins with a C-terminal extension that are differentially targeted to somatic centrioles and thought to be crucial for the formation of microtubule organizing centers. |
| Application | ELISA, IF, IHC, WB |
| Application Notes | WB: 1/500 IF: 1/10-1/500 IHC: 1/10-1/500 |
| Shipping | Shipped on dry ice. |
| Storage | Store at 4 °C: short-term (1-2 weeks) Store at -20 °C: long-term and future use |
| Buffer | PBS, pH 7.4 |
For Research Use Only. Not For Clinical Use.Related Products
Copyright © 2025 CD BioSciences. All rights reserved.